PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35149.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 283aa    MW: 31959.9 Da    PI: 6.6811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35149.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.86e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lvd ++++G g+W++ +r  g++R++k+c++rw +yl
       KHN35149.1 16 KGPWSPEEDKILVDFIEKHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 63
                     79********************************************97 PP

2Myb_DNA-binding51.71.9e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++l+++++  lG++ W++Ia++++ gRt++++k+ w+++l
       KHN35149.1  69 RGKFSDEEEQLIINLHSVLGNK-WAAIASHLP-GRTDNEIKNLWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4731163IPR017930Myb domain
SuperFamilySSF466891.19E-3113110IPR009057Homeodomain-like
SMARTSM007172.4E-151565IPR001005SANT/Myb domain
PfamPF002495.0E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-241770IPR009057Homeodomain-like
CDDcd001674.64E-121863No hitNo description
PROSITE profilePS5129426.3564118IPR017930Myb domain
SMARTSM007175.8E-1568116IPR001005SANT/Myb domain
PfamPF002492.4E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2771119IPR009057Homeodomain-like
CDDcd001672.89E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
VMMRTPISSD ESGLKKGPWS PEEDKILVDF IEKHGHGSWR ALPRLAGLNR CGKSCRLRWT  60
NYLRPDIKRG KFSDEEEQLI INLHSVLGNK WAAIASHLPG RTDNEIKNLW NTHLKKKLMQ  120
MGLDPVTHRP RTHHLNLLSN LQQILALIRL QSDANKLQLL QNIFEASNSD PLPDSSYSLL  180
NDVLGGLNNL HSNDLHNLYD GNSLSVQNFD QNLNGGRNAE PSPSSNSLPN LVSASPDRSP  240
VVKEAQNILV NSKDFSTSAF ELTWGDFMDE EETNQTYWKG FME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29141185108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150437e-84AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538653.30.0PREDICTED: transcription repressor MYB6-like
SwissprotQ8GWP01e-69MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0B2RSB40.0A0A0B2RSB4_GLYSO; Transcription factor MYB39 (Fragment)
STRINGGLYMA11G01150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.27e-81myb domain protein 9
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]